Lineage for d1kcba2 (1kcb A:167-340)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries)
  8. Domain d1kcba2: 1kcb A:167-340 [90952]
    Other proteins in same PDB: d1kcba1
    complexed with cu; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1kcba2

PDB Entry: 1kcb (more details), 1.65 Å

PDB Description: Crystal Structure of a NO-forming Nitrite Reductase Mutant: an Analog of a Transition State in Enzymatic Reaction
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1kcba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcba2 b.6.1.3 (A:167-340) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphlegghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d1kcba2 are not available.

Timeline for d1kcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcba1