SCOP 1.75: Domain d1kcba1: 1kcb A:8-166

Lineage for d1kcba1 (1kcb A:8-166)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (10 PDB entries)

8. Domain d1kcba1: 1kcb A:8-166 [90951]

Details for d1kcba1

PDB Entry: 1kcb, 1.65 Å

PDB Description: crystal structure of a no-forming nitrite reductase mutant: an analog of a transition state in enzymatic reaction

PDB Compounds: (A:) nitrite reductase

SCOP Domain Sequences for d1kcba1:

Sequence; same for both SEQRES and ATOM records:

>d1kcba1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d1kcba1:

• d1kcba1 first appeared in SCOP 1.67
  
• d1kcba1 appears in SCOP 1.73
  
• d1kcba1 appears in SCOPe 2.01
  
• d1kcba1 appears in the current release, SCOPe 2.08