Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Response regulator for cyanobacterial phytochrome [75152] (3 species) |
Species Calothrix sp. pcc 7601, RcpA [TaxId:1188] [102226] (1 PDB entry) |
Domain d1k68b_: 1k68 B: [90944] phosphorylated complexed with mg |
PDB Entry: 1k68 (more details), 1.9 Å
SCOPe Domain Sequences for d1k68b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k68b_ c.23.1.1 (B:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} ahkkiflvednkadirliqealanstvphevvtvrdgmeamaylrqegeyanasrpdlil ldlnlpkkdgrevlaeiksdptlkripvvvlstsineddifhsydlhvncyitksanlsq lfqivkgieefwlstatlps
Timeline for d1k68b_: