SCOPe 2.05: Domain d1k68a_: 1k68 A:

Lineage for d1k68a_ (1k68 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)

7. Species Calothrix sp. pcc 7601, RcpA [TaxId:1188] [102226] (1 PDB entry)

8. Domain d1k68a_: 1k68 A: [90943]
   phosphorylated
   complexed with mg

Details for d1k68a_

PDB Entry: 1k68, 1.9 Å

PDB Description: Crystal Structure of the Phosphorylated Cyanobacterial Phytochrome Response Regulator RcpA

PDB Compounds: (A:) Phytochrome Response Regulator RcpA

SCOPe Domain Sequences for d1k68a_:

Sequence; same for both SEQRES and ATOM records:

>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]}
ahkkiflvednkadirliqealanstvphevvtvrdgmeamaylrqegeyanasrpdlil
ldlnlpkkdgrevlaeiksdptlkripvvvlstsineddifhsydlhvncyitksanlsq
lfqivkgieefwlstatlps

Timeline for d1k68a_:

• d1k68a_ first appeared in SCOP 1.67
  
• d1k68a_ appears in SCOPe 2.04
  
• d1k68a_ appears in SCOPe 2.06
  
• d1k68a_ appears in the current release, SCOPe 2.08