Lineage for d1k68a_ (1k68 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 390874Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 390875Family c.23.1.1: CheY-related [52173] (16 proteins)
  6. 390986Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)
  7. 390987Species Calothrix sp. pcc 7601, RcpA [TaxId:1188] [102226] (1 PDB entry)
  8. 390988Domain d1k68a_: 1k68 A: [90943]

Details for d1k68a_

PDB Entry: 1k68 (more details), 1.9 Å

PDB Description: Crystal Structure of the Phosphorylated Cyanobacterial Phytochrome Response Regulator RcpA

SCOP Domain Sequences for d1k68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA}
ahkkiflvednkadirliqealanstvphevvtvrdgmeamaylrqegeyanasrpdlil
lxlnlpkkdgrevlaeiksdptlkripvvvlstsineddifhsydlhvncyitksanlsq
lfqivkgieefwlstatlps

SCOP Domain Coordinates for d1k68a_:

Click to download the PDB-style file with coordinates for d1k68a_.
(The format of our PDB-style files is described here.)

Timeline for d1k68a_: