| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (5 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (16 proteins) |
| Protein Response regulator for cyanobacterial phytochrome [75152] (3 species) |
| Species Calothrix sp. pcc 7601, RcpA [TaxId:1188] [102226] (1 PDB entry) |
| Domain d1k68a_: 1k68 A: [90943] |
PDB Entry: 1k68 (more details), 1.9 Å
SCOP Domain Sequences for d1k68a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA}
ahkkiflvednkadirliqealanstvphevvtvrdgmeamaylrqegeyanasrpdlil
lxlnlpkkdgrevlaeiksdptlkripvvvlstsineddifhsydlhvncyitksanlsq
lfqivkgieefwlstatlps
Timeline for d1k68a_: