Lineage for d1k63a_ (1k63 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869649Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 1869650Protein Haloalkane dehalogenase [53514] (4 species)
  7. 1869657Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries)
  8. 1869662Domain d1k63a_: 1k63 A: [90939]
    complexed with br, brp, cl, mg

Details for d1k63a_

PDB Entry: 1k63 (more details), 1.8 Å

PDB Description: complex of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis with ut26 2-bromo-2-propene-1-ol at 1.8a resolution
PDB Compounds: (A:) 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase

SCOPe Domain Sequences for d1k63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k63a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}
slgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliac
dligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrh
rervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrp
lseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfi
naepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

SCOPe Domain Coordinates for d1k63a_:

Click to download the PDB-style file with coordinates for d1k63a_.
(The format of our PDB-style files is described here.)

Timeline for d1k63a_: