SCOP 1.75: Domain d1k39c_: 1k39 C:

Lineage for d1k39c_ (1k39 C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (4 PDB entries)

8. Domain d1k39c_: 1k39 C: [90935]
   complexed with co8, po4; mutant

Details for d1k39c_

PDB Entry: 1k39, 3.29 Å

PDB Description: the structure of yeast delta3-delta2-enoyl-coa isomerase complexed with octanoyl-coa

PDB Compounds: (C:) d3,d2-enoyl coa isomerase eci1

SCOP Domain Sequences for d1k39c_:

Sequence; same for both SEQRES and ATOM records:

>d1k39c_ c.14.1.3 (C:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
irqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgr
ffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpai
glsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpf
kydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidaf
nkansvevneslkywvdgeplkrfrq

Timeline for d1k39c_:

• d1k39c_ first appeared in SCOP 1.67
  
• d1k39c_ appears in SCOP 1.73
  
• d1k39c_ appears in SCOPe 2.01
  
• d1k39c_ appears in the current release, SCOPe 2.08