Lineage for d1k39c_ (1k39 C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690824Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (4 species)
  7. 690825Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (4 PDB entries)
  8. 690833Domain d1k39c_: 1k39 C: [90935]
    complexed with co8, po4; mutant

Details for d1k39c_

PDB Entry: 1k39 (more details), 3.29 Å

PDB Description: the structure of yeast delta3-delta2-enoyl-coa isomerase complexed with octanoyl-coa
PDB Compounds: (C:) d3,d2-enoyl coa isomerase eci1

SCOP Domain Sequences for d1k39c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k39c_ c.14.1.3 (C:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
irqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgr
ffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpai
glsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpf
kydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidaf
nkansvevneslkywvdgeplkrfrq

SCOP Domain Coordinates for d1k39c_:

Click to download the PDB-style file with coordinates for d1k39c_.
(The format of our PDB-style files is described here.)

Timeline for d1k39c_: