![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (4 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (7 proteins) |
![]() | Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (4 PDB entries) |
![]() | Domain d1k39c_: 1k39 C: [90935] complexed with co8, po4; mutant |
PDB Entry: 1k39 (more details), 3.29 Å
SCOP Domain Sequences for d1k39c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k39c_ c.14.1.3 (C:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae)} irqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgr ffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpai glsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpf kydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidaf nkansvevneslkywvdgeplkrfrq
Timeline for d1k39c_: