Lineage for d1k39b_ (1k39 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853134Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (5 species)
  7. 2853135Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (4 PDB entries)
  8. 2853142Domain d1k39b_: 1k39 B: [90934]
    complexed with co8, po4

Details for d1k39b_

PDB Entry: 1k39 (more details), 3.29 Å

PDB Description: the structure of yeast delta3-delta2-enoyl-coa isomerase complexed with octanoyl-coa
PDB Compounds: (B:) d3,d2-enoyl coa isomerase eci1

SCOPe Domain Sequences for d1k39b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k39b_ c.14.1.3 (B:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa
iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp
fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida
fnkansvevneslkywvdgeplkrfrqlgsk

SCOPe Domain Coordinates for d1k39b_:

Click to download the PDB-style file with coordinates for d1k39b_.
(The format of our PDB-style files is described here.)

Timeline for d1k39b_: