Lineage for d1k39a_ (1k39 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390233Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 390234Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 390288Family c.14.1.3: Crotonase-like [52103] (7 proteins)
  6. 390313Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (2 species)
  7. 390314Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63954] (4 PDB entries)
  8. 390320Domain d1k39a_: 1k39 A: [90933]

Details for d1k39a_

PDB Entry: 1k39 (more details), 3.29 Å

PDB Description: the structure of yeast delta3-delta2-enoyl-coa isomerase complexed with octanoyl-coa

SCOP Domain Sequences for d1k39a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k39a_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae)}
eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa
iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp
fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida
fnkansvevneslkywvdgeplkrfrqlg

SCOP Domain Coordinates for d1k39a_:

Click to download the PDB-style file with coordinates for d1k39a_.
(The format of our PDB-style files is described here.)

Timeline for d1k39a_: