Lineage for d1k37a_ (1k37 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031323Protein Epiregulin, EGF-domain [103561] (1 species)
  7. 3031324Species Human (Homo sapiens) [TaxId:9606] [103562] (2 PDB entries)
  8. 3031326Domain d1k37a_: 1k37 A: [90932]

Details for d1k37a_

PDB Entry: 1k37 (more details)

PDB Description: nmr structure of human epiregulin
PDB Compounds: (A:) Epiregulin

SCOPe Domain Sequences for d1k37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k37a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
vsitkcssdmngyclhgqciylvdmsqnycrcevgytgvrcehffl

SCOPe Domain Coordinates for d1k37a_:

Click to download the PDB-style file with coordinates for d1k37a_.
(The format of our PDB-style files is described here.)

Timeline for d1k37a_: