SCOPe 2.07: Domain d1k2x.2: 1k2x C:,D:

Lineage for d1k2x.2 (1k2x C:,D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins)
   automatically mapped to Pfam PF01112

6. Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species)
   the precursor chain is cleaved onto 2 fragments by autoproteolysis

7. Species Escherichia coli [TaxId:562] [103315] (3 PDB entries)
   Uniprot P37595
   isoaspartyl peptidase with L-asparaginase activity
   putative L-asparaginase YbiK

8. Domain d1k2x.2: 1k2x C:,D: [90930]
   complexed with cl, na

Details for d1k2x.2

PDB Entry: 1k2x, 1.65 Å

PDB Description: Crystal structure of putative asparaginase encoded by Escherichia coli ybiK gene

PDB Compounds: (C:) Putative L-asparaginase, (D:) Putative L-asparaginase

SCOPe Domain Sequences for d1k2x.2:

Sequence; same for both SEQRES and ATOM records:

>g1k2x.2 d.153.1.5 (C:,D:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Escherichia coli [TaxId: 562]}
gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
migegaenfafargmervspeifstslryeqllaarXtvgavaldldgnlaaatstggmt
nklpgrvgdsplvgagcyannasvavsctgtgevfiralaaydiaalmdygglslaeace
rvvmeklpalggsggliaidhegnvalpfntegmyrawgyagdtpttgiyre

Timeline for d1k2x.2:

• d1k2x.2 first appeared in SCOP 1.67
  
• d1k2x.2 appears in SCOPe 2.06
  
• d1k2x.2 appears in the current release, SCOPe 2.08