Lineage for d1k2x.2 (1k2x C:,D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612721Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 612722Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 613175Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)
  6. 613176Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 613177Species Escherichia coli [TaxId:562] [103315] (3 PDB entries)
    isoaspartyl peptidase with L-asparaginase activity
    putative L-asparaginase YbiK
  8. 613179Domain d1k2x.2: 1k2x C:,D: [90930]
    complexed with cl, na

Details for d1k2x.2

PDB Entry: 1k2x (more details), 1.65 Å

PDB Description: Crystal structure of putative asparaginase encoded by Escherichia coli ybiK gene

SCOP Domain Sequences for d1k2x.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1k2x.2 d.153.1.5 (C:,D:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Escherichia coli}
gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
migegaenfafargmervspeifstslryeqllaarXtvgavaldldgnlaaatstggmt
nklpgrvgdsplvgagcyannasvavsctgtgevfiralaaydiaalmdygglslaeace
rvvmeklpalggsggliaidhegnvalpfntegmyrawgyagdtpttgiyre

SCOP Domain Coordinates for d1k2x.2:

Click to download the PDB-style file with coordinates for d1k2x.2.
(The format of our PDB-style files is described here.)

Timeline for d1k2x.2: