Lineage for d1k2wb_ (1k2w B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842810Protein Sorbitol dehydrogenase [102148] (1 species)
  7. 2842811Species Rhodobacter sphaeroides [TaxId:1063] [102149] (1 PDB entry)
  8. 2842813Domain d1k2wb_: 1k2w B: [90928]

Details for d1k2wb_

PDB Entry: 1k2w (more details), 2.4 Å

PDB Description: crystal structure of sorbitol dehydrogenase from r. sphaeroides
PDB Compounds: (B:) sorbitol dehydrogenase

SCOPe Domain Sequences for d1k2wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2wb_ c.2.1.2 (B:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}
mrldgktalitgsargigrafaeayvregarvaiadinleaarataaeigpaacaialdv
tdqasidrcvaelldrwgsidilvnnaalfdlapiveitresydrlfainvsgtlfmmqa
varamiaggrggkiinmasqagrrgealvgvycatkaavisltqsaglnlirhginvnai
apgvvdgehwdgvdakfadyenlprgekkrqvgaavpfgrmgraedltgmaiflatpead
yivaqtynvdggnwms

SCOPe Domain Coordinates for d1k2wb_:

Click to download the PDB-style file with coordinates for d1k2wb_.
(The format of our PDB-style files is described here.)

Timeline for d1k2wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k2wa_