Lineage for d1jy0b_ (1jy0 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375318Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 375319Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 375320Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 375334Species Human (Homo sapiens) [TaxId:9606] [50359] (23 PDB entries)
  8. 375350Domain d1jy0b_: 1jy0 B: [90924]
    complexed with fmt; mutant

Details for d1jy0b_

PDB Entry: 1jy0 (more details), 1.7 Å

PDB Description: Human acidic fibroblast growth factor. 141 amino acid form with amino terminal His tag and Cys 117 replaced with Val (C117V).

SCOP Domain Sequences for d1jy0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy0b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
vkrgprthygqkailflplpv

SCOP Domain Coordinates for d1jy0b_:

Click to download the PDB-style file with coordinates for d1jy0b_.
(The format of our PDB-style files is described here.)

Timeline for d1jy0b_: