Lineage for d1jvfd_ (1jvf D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387288Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (40 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 387487Protein Enoyl-ACP reductase [51791] (5 species)
  7. 387523Species Helicobacter pylori [TaxId:210] [102151] (2 PDB entries)
  8. 387531Domain d1jvfd_: 1jvf D: [90916]
    complexed with nad, tcl

Details for d1jvfd_

PDB Entry: 1jvf (more details), 2.5 Å

PDB Description: Crystal structure of Enoyl-Acyl Carrier protein Reductase from Helicobacter pylori

SCOP Domain Sequences for d1jvfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvfd_ c.2.1.2 (D:) Enoyl-ACP reductase {Helicobacter pylori}
gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
evhfvdagyhvmgmgaveekdnkatllwdlhkeq

SCOP Domain Coordinates for d1jvfd_:

Click to download the PDB-style file with coordinates for d1jvfd_.
(The format of our PDB-style files is described here.)

Timeline for d1jvfd_: