Lineage for d1juva_ (1juv A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401379Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 401380Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 401381Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 401396Protein Dihydrofolate reductase, prokaryotic type [53599] (6 species)
  7. 401397Species Bacteriophage T4 [TaxId:10665] [102635] (1 PDB entry)
  8. 401398Domain d1juva_: 1juv A: [90912]
    complexed with ndp

Details for d1juva_

PDB Entry: 1juv (more details), 1.7 Å

PDB Description: Crystal structure analysis of Dihydrofolate reductase from Bacteriophage T4

SCOP Domain Sequences for d1juva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4}
miklvfrysptktvdgfnelafglgdglpwgrvkkdlqnfkartegtimimgaktfqslp
tllpgrshivvcdlardypvtkdgdlahfyitweqyityisggeiqvsspnapfetmldq
nskvsviggpallyaalpyadevvvsrivkrhrvnstvqldasflddiskremvethwyk
idevttltesvyk

SCOP Domain Coordinates for d1juva_:

Click to download the PDB-style file with coordinates for d1juva_.
(The format of our PDB-style files is described here.)

Timeline for d1juva_: