Lineage for d1jrca_ (1jrc A:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins) 
Protein Dihydroorotate dehydrogenase [51397] (5 species) Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries) 
Domain d1jrca_: 1jrc A: [90906]
Details for d1jrca_
PDB Entry: 1jrc (more details), 1.8 Å
PDB Description: the n67a mutant of lactococcus lactis dihydroorotate dehydrogenase a
SCOP Domain Sequences for d1jrca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrca_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsiasmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl
SCOP Domain Coordinates for d1jrca_:
Click to download the PDB-style file with coordinates for d1jrca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jrca_:
- d1jrca_ is new in SCOP 1.67
- d1jrca_ appears in SCOP 1.69
- d1jrca_ appears in the current release, SCOPe 2.08
View in 3D
