Lineage for d1jqvb_ (1jqv B:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins) 
Protein Dihydroorotate dehydrogenase [51397] (5 species) Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries) 
Domain d1jqvb_: 1jqv B: [90901]
Details for d1jqvb_
PDB Entry: 1jqv (more details), 2.1 Å
PDB Description: the k213e mutant of lactococcus lactis dihydroorotate dehydrogenase a
SCOP Domain Sequences for d1jqvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jqvb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpedgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl
SCOP Domain Coordinates for d1jqvb_:
Click to download the PDB-style file with coordinates for d1jqvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jqvb_:
- d1jqvb_ first appeared in SCOP 1.67
- d1jqvb_ appears in SCOP 1.71
- d1jqvb_ appears in the current release, SCOPe 2.08
View in 3D
