Lineage for d1jn9.1 (1jn9 A:,B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995809Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins)
    automatically mapped to Pfam PF01112
  6. 2995810Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 2995817Species Escherichia coli [TaxId:562] [103315] (3 PDB entries)
    Uniprot P37595
    isoaspartyl peptidase with L-asparaginase activity
    putative L-asparaginase YbiK
  8. 2995822Domain d1jn9.1: 1jn9 A:,B: [90898]
    complexed with ca, cl, na

Details for d1jn9.1

PDB Entry: 1jn9 (more details), 2.3 Å

PDB Description: Structure of Putative Asparaginase Encoded by Escherichia coli ybiK Gene
PDB Compounds: (A:) Putative L-asparaginase, (B:) Putative L-asparaginase

SCOPe Domain Sequences for d1jn9.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jn9.1 d.153.1.5 (A:,B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Escherichia coli [TaxId: 562]}
gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
migegaenfafargmervspeifstslryeqllaarkeXtvgavaldldgnlaaatstgg
mtnklpgrvgdsplvgagcyannasvavsctgtgevfiralaaydiaalmdygglslaea
cervvmeklpalggsggliaidhegnvalpfntegmyrawgyagdtpttgiyr

SCOPe Domain Coordinates for d1jn9.1:

Click to download the PDB-style file with coordinates for d1jn9.1.
(The format of our PDB-style files is described here.)

Timeline for d1jn9.1: