Lineage for d1jasa_ (1jas A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2183831Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2183934Species Human (Homo sapiens), ubc2b [TaxId:9606] [102840] (4 PDB entries)
    E2-17 kDa
  8. 2183938Domain d1jasa_: 1jas A: [90882]

Details for d1jasa_

PDB Entry: 1jas (more details)

PDB Description: hsubc2b
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-17 kda

SCOPe Domain Sequences for d1jasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jasa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc2b [TaxId: 9606]}
mstparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefs
eeypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpns
pansqaaqlyqenkreyekrvsaiveqswnds

SCOPe Domain Coordinates for d1jasa_:

Click to download the PDB-style file with coordinates for d1jasa_.
(The format of our PDB-style files is described here.)

Timeline for d1jasa_: