SCOP 1.67: Domain d1j56a_: 1j56 A:

Lineage for d1j56a_ (1j56 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.1: CheY-related [52173] (16 proteins)

6. Protein NTRC receiver domain [52180] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52181] (6 PDB entries)

8. Domain d1j56a_: 1j56 A: [90881]
   complexed with bef

Details for d1j56a_

PDB Entry: 1j56

PDB Description: minimized average structure of beryllofluoride-activated ntrc receiver domain: model structure incorporating active site contacts

SCOP Domain Sequences for d1j56a_:

Sequence; same for both SEQRES and ATOM records:

>d1j56a_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium}
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe

Timeline for d1j56a_:

• d1j56a_ is new in SCOP 1.67
  
• d1j56a_ appears in SCOP 1.69
  
• d1j56a_ appears in the current release, SCOPe 2.08