![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) ![]() alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
![]() | Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins) Pfam 03259 |
![]() | Protein Giding protein MglB [103198] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [103199] (1 PDB entry) |
![]() | Domain d1j3wd_: 1j3w D: [90836] structural genomics complexed with mes, mg, so4 |
PDB Entry: 1j3w (more details), 1.5 Å
SCOP Domain Sequences for d1j3wd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3wd_ d.110.7.1 (D:) Giding protein MglB {Thermus thermophilus} lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra sealariaeeala
Timeline for d1j3wd_: