SCOPe 2.05: Domain d1j3wc_: 1j3w C:

Lineage for d1j3wc_ (1j3w C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Giding protein MglB [103198] (1 species)

7. Species Thermus thermophilus [TaxId:274] [103199] (1 PDB entry)

8. Domain d1j3wc_: 1j3w C: [90835]
   structural genomics
   complexed with mes, mg, so4

Details for d1j3wc_

PDB Entry: 1j3w, 1.5 Å

PDB Description: Structure of Gliding protein-mglB from Thermus Thermophilus HB8

PDB Compounds: (C:) Giding protein-mglB

SCOPe Domain Sequences for d1j3wc_:

Sequence; same for both SEQRES and ATOM records:

>d1j3wc_ d.110.7.1 (C:) Giding protein MglB {Thermus thermophilus [TaxId: 274]}
lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag
naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra
sealariaeeala

Timeline for d1j3wc_:

• d1j3wc_ first appeared in SCOP 1.67
  
• d1j3wc_ appears in SCOPe 2.04
  
• d1j3wc_ appears in SCOPe 2.06
  
• d1j3wc_ appears in the current release, SCOPe 2.08