Lineage for d1j3wc_ (1j3w C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. Protein Giding protein MglB [103198] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [103199] (1 PDB entry)
  8. Domain d1j3wc_: 1j3w C: [90835]
    structural genomics
    complexed with mes, mg, so4

Details for d1j3wc_

PDB Entry: 1j3w (more details), 1.5 Å

PDB Description: Structure of Gliding protein-mglB from Thermus Thermophilus HB8
PDB Compounds: (C:) Giding protein-mglB

SCOPe Domain Sequences for d1j3wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3wc_ d.110.7.1 (C:) Giding protein MglB {Thermus thermophilus [TaxId: 274]}
lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag
naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra
sealariaeeala

SCOPe Domain Coordinates for d1j3wc_ are not available.

Timeline for d1j3wc_:

Domains from other chains:
(mouse over for more information)
d1j3wa_, d1j3wb_, d1j3wd_