Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.110: Profilin-like [55769] (9 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins) Pfam PF03259 |
Protein Giding protein MglB [103198] (1 species) |
Species Thermus thermophilus [TaxId:274] [103199] (1 PDB entry) |
Domain d1j3wa_: 1j3w A: [90833] |
PDB Entry: 1j3w (more details), 1.5 Å
SCOP Domain Sequences for d1j3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3wa_ d.110.7.1 (A:) Giding protein MglB {Thermus thermophilus [TaxId: 274]} lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra sealariaeealan
Timeline for d1j3wa_: