Lineage for d1j3wa_ (1j3w A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731846Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 731847Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins)
    Pfam PF03259
  6. 731851Protein Giding protein MglB [103198] (1 species)
  7. 731852Species Thermus thermophilus [TaxId:274] [103199] (1 PDB entry)
  8. 731853Domain d1j3wa_: 1j3w A: [90833]

Details for d1j3wa_

PDB Entry: 1j3w (more details), 1.5 Å

PDB Description: Structure of Gliding protein-mglB from Thermus Thermophilus HB8
PDB Compounds: (A:) Giding protein-mglB

SCOP Domain Sequences for d1j3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3wa_ d.110.7.1 (A:) Giding protein MglB {Thermus thermophilus [TaxId: 274]}
lvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlatlvag
naaatqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkra
sealariaeealan

SCOP Domain Coordinates for d1j3wa_:

Click to download the PDB-style file with coordinates for d1j3wa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3wa_: