Lineage for d1j3vd2 (1j3v D:2-157)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478456Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (14 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 478525Protein Hydroxyisobutyrate dehydrogenase [102171] (2 species)
  7. 478528Species Thermus thermophilus [TaxId:274] [102172] (1 PDB entry)
  8. 478532Domain d1j3vd2: 1j3v D:2-157 [90832]
    Other proteins in same PDB: d1j3va1, d1j3vb1, d1j3vc1, d1j3vd1
    structural genomics

Details for d1j3vd2

PDB Entry: 1j3v (more details), 1.8 Å

PDB Description: Structure of Hydroxyisobutyrate Dehydrogenase from Thermus Thermophilus HB8

SCOP Domain Sequences for d1j3vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3vd2 c.2.1.6 (D:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus}
ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
gaeagtltvmlggpeeavervrpflayakkvvhvgp

SCOP Domain Coordinates for d1j3vd2:

Click to download the PDB-style file with coordinates for d1j3vd2.
(The format of our PDB-style files is described here.)

Timeline for d1j3vd2: