Lineage for d1j3vd1 (1j3v D:158-289)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541599Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 541600Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (10 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 541601Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 541612Protein Hydroxyisobutyrate dehydrogenase [101357] (2 species)
    forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively
  7. 541615Species Thermus thermophilus [TaxId:274] [101358] (1 PDB entry)
  8. 541619Domain d1j3vd1: 1j3v D:158-289 [90831]
    Other proteins in same PDB: d1j3va2, d1j3vb2, d1j3vc2, d1j3vd2
    structural genomics
    complexed with ndp

Details for d1j3vd1

PDB Entry: 1j3v (more details), 1.8 Å

PDB Description: Structure of Hydroxyisobutyrate Dehydrogenase from Thermus Thermophilus HB8

SCOP Domain Sequences for d1j3vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3vd1 a.100.1.1 (D:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus}
vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr
vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal
rllerwggveir

SCOP Domain Coordinates for d1j3vd1:

Click to download the PDB-style file with coordinates for d1j3vd1.
(The format of our PDB-style files is described here.)

Timeline for d1j3vd1: