![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
![]() | Protein Hydroxyisobutyrate dehydrogenase [101357] (1 species) forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively |
![]() | Species Thermus thermophilus [TaxId:274] [101358] (1 PDB entry) |
![]() | Domain d1j3vd1: 1j3v D:158-289 [90831] Other proteins in same PDB: d1j3va2, d1j3vb2, d1j3vc2, d1j3vd2 structural genomics complexed with ndp |
PDB Entry: 1j3v (more details), 1.8 Å
SCOP Domain Sequences for d1j3vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3vd1 a.100.1.1 (D:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus} vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal rllerwggveir
Timeline for d1j3vd1: