Lineage for d1j3rb_ (1j3r B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381160Superfamily b.82.1: RmlC-like cupins [51182] (12 families) (S)
  5. 381321Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)
  6. 381322Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 381331Species Archaeon Thermococcus litoralis [TaxId:2265] [101975] (3 PDB entries)
  8. 381337Domain d1j3rb_: 1j3r B: [90824]
    complexed with 6pg, fe

Details for d1j3rb_

PDB Entry: 1j3r (more details), 2.18 Å

PDB Description: crystal structure of thermococcus litoralis phosphogrucose isomerase complexed with gluconate-6-phosphate

SCOP Domain Sequences for d1j3rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3rb_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Archaeon Thermococcus litoralis}
ykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieqee
kegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearfie
mepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkvvv
kdnpk

SCOP Domain Coordinates for d1j3rb_:

Click to download the PDB-style file with coordinates for d1j3rb_.
(The format of our PDB-style files is described here.)

Timeline for d1j3rb_: