SCOPe 2.08: Domain d1j3qb_: 1j3q B:

Lineage for d1j3qb_ (1j3q B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
   automatically mapped to Pfam PF06560

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Thermococcus litoralis [TaxId:2265] [101975] (3 PDB entries)

8. Domain d1j3qb_: 1j3q B: [90822]
   complexed with fe

Details for d1j3qb_

PDB Entry: 1j3q, 1.85 Å

PDB Description: Crystal structure of Thermococcus litoralis phosphogrucose isomerase soaked with FeSO4

PDB Compounds: (B:) phosphoglucose isomerase

SCOPe Domain Sequences for d1j3qb_:

Sequence; same for both SEQRES and ATOM records:

>d1j3qb_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Thermococcus litoralis [TaxId: 2265]}
ykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieqee
kegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearfie
mepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkvvv
kdn

Timeline for d1j3qb_:

• d1j3qb_ first appeared in SCOP 1.67
  
• d1j3qb_ appears in SCOPe 2.07