SCOP 1.75: Domain d1j3qa_: 1j3q A:

Lineage for d1j3qa_ (1j3q A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Archaeon Thermococcus litoralis [TaxId:2265] [101975] (7 PDB entries)

8. Domain d1j3qa_: 1j3q A: [90821]

Details for d1j3qa_

PDB Entry: 1j3q, 1.85 Å

PDB Description: Crystal structure of Thermococcus litoralis phosphogrucose isomerase soaked with FeSO4

PDB Compounds: (A:) phosphoglucose isomerase

SCOP Domain Sequences for d1j3qa_:

Sequence; same for both SEQRES and ATOM records:

>d1j3qa_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Thermococcus litoralis [TaxId: 2265]}
mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
vvkdnpk

Timeline for d1j3qa_:

• d1j3qa_ first appeared in SCOP 1.67
  
• d1j3qa_ appears in SCOP 1.73
  
• d1j3qa_ appears in SCOPe 2.01
  
• d1j3qa_ appears in the current release, SCOPe 2.08