Lineage for d1j3le_ (1j3l E:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479747Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 480068Superfamily c.8.7: RraA-like [89562] (1 family) (S)
    structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase
  5. 480069Family c.8.7.1: RraA-like [89563] (4 proteins)
    aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
  6. 480070Protein Demethylmenaquinone methyltransferase [102196] (1 species)
    as (mis)annotated in the PDB entry; RraA homologue
  7. 480071Species Thermus thermophilus [TaxId:274] [102197] (1 PDB entry)
  8. 480076Domain d1j3le_: 1j3l E: [90817]

Details for d1j3le_

PDB Entry: 1j3l (more details), 2.3 Å

PDB Description: Structure of the RNA-processing inhibitor RraA from Thermus thermophilis

SCOP Domain Sequences for d1j3le_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3le_ c.8.7.1 (E:) Demethylmenaquinone methyltransferase {Thermus thermophilus}
mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg

SCOP Domain Coordinates for d1j3le_:

Click to download the PDB-style file with coordinates for d1j3le_.
(The format of our PDB-style files is described here.)

Timeline for d1j3le_: