SCOPe 2.08: Domain d1j3le_: 1j3l E:

Lineage for d1j3le_ (1j3l E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.7: RraA-like [89562] (2 families)
   structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase

5. Family c.8.7.1: RraA-like [89563] (5 proteins)
   aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
   automatically mapped to Pfam PF03737

6. Protein Demethylmenaquinone methyltransferase [102196] (1 species)
   as (mis)annotated in the PDB entry; RraA homologue

7. Species Thermus thermophilus [TaxId:274] [102197] (1 PDB entry)

8. Domain d1j3le_: 1j3l E: [90817]
   complexed with cl, mg

Details for d1j3le_

PDB Entry: 1j3l, 2.3 Å

PDB Description: Structure of the RNA-processing inhibitor RraA from Thermus thermophilis

PDB Compounds: (E:) Demethylmenaquinone Methyltransferase

SCOPe Domain Sequences for d1j3le_:

Sequence; same for both SEQRES and ATOM records:

>d1j3le_ c.8.7.1 (E:) Demethylmenaquinone methyltransferase {Thermus thermophilus [TaxId: 274]}
mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg

Timeline for d1j3le_:

• d1j3le_ first appeared in SCOP 1.67
  
• d1j3le_ appears in SCOPe 2.07