SCOP 1.71: Domain d1j3lb_: 1j3l B:

Lineage for d1j3lb_ (1j3l B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.7: RraA-like [89562] (1 family)
   structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase

5. Family c.8.7.1: RraA-like [89563] (4 proteins)
   aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli

6. Protein Demethylmenaquinone methyltransferase [102196] (1 species)
   as (mis)annotated in the PDB entry; RraA homologue

7. Species Thermus thermophilus [TaxId:274] [102197] (1 PDB entry)

8. Domain d1j3lb_: 1j3l B: [90814]

Details for d1j3lb_

PDB Entry: 1j3l, 2.3 Å

PDB Description: Structure of the RNA-processing inhibitor RraA from Thermus thermophilis

SCOP Domain Sequences for d1j3lb_:

Sequence; same for both SEQRES and ATOM records:

>d1j3lb_ c.8.7.1 (B:) Demethylmenaquinone methyltransferase {Thermus thermophilus}
mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl
fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak
egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg

Timeline for d1j3lb_:

• d1j3lb_ first appeared in SCOP 1.67
  
• d1j3lb_ appears in SCOP 1.69
  
• d1j3lb_ appears in SCOP 1.73
  
• d1j3lb_ appears in the current release, SCOPe 2.08