![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.7: RraA-like [89562] (1 family) ![]() structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase |
![]() | Family c.8.7.1: RraA-like [89563] (4 proteins) aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli |
![]() | Protein Demethylmenaquinone methyltransferase [102196] (1 species) as (mis)annotated in the PDB entry; RraA homologue |
![]() | Species Thermus thermophilus [TaxId:274] [102197] (1 PDB entry) |
![]() | Domain d1j3lb_: 1j3l B: [90814] |
PDB Entry: 1j3l (more details), 2.3 Å
SCOP Domain Sequences for d1j3lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3lb_ c.8.7.1 (B:) Demethylmenaquinone methyltransferase {Thermus thermophilus} mearttdlsdlypegealpmvfksfggrarfagrvrtlrvfednalvrkvleeegagqvl fvdgggslrtallggnlarrawekgwagvvvhgavrdteelrevpigllalaatpkksak egkgevdvplkvlgvevlpgsflladedgllllpeppsgvrsgg
Timeline for d1j3lb_: