Lineage for d1j31c_ (1j31 C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513563Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513564Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (2 families) (S)
    Pfam 00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. 513574Family d.160.1.2: Carbamilase [64433] (2 proteins)
  6. 513575Protein Hypothetical protein PH0642 [103323] (1 species)
  7. 513576Species Archaeon Pyrococcus horikoshii [TaxId:53953] [103324] (1 PDB entry)
  8. 513579Domain d1j31c_: 1j31 C: [90810]

Details for d1j31c_

PDB Entry: 1j31 (more details), 1.6 Å

PDB Description: Crystal Structure of Hypothetical Protein PH0642 from Pyrococcus horikoshii

SCOP Domain Sequences for d1j31c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j31c_ d.160.1.2 (C:) Hypothetical protein PH0642 {Archaeon Pyrococcus horikoshii}
mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra
mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
rnkrlndmndifkdrreeyyfr

SCOP Domain Coordinates for d1j31c_:

Click to download the PDB-style file with coordinates for d1j31c_.
(The format of our PDB-style files is described here.)

Timeline for d1j31c_: