![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) ![]() Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases |
![]() | Family d.160.1.2: Carbamilase [64433] (3 proteins) |
![]() | Protein Hypothetical protein PH0642 [103323] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [103324] (1 PDB entry) |
![]() | Domain d1j31b_: 1j31 B: [90809] complexed with act |
PDB Entry: 1j31 (more details), 1.6 Å
SCOPe Domain Sequences for d1j31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j31b_ d.160.1.2 (B:) Hypothetical protein PH0642 {Pyrococcus horikoshii [TaxId: 53953]} mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre kvffepgdlgfkvfdigfakvgvmicfdwffpesartlalkgaeiiahpanlvmpyapra mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla rnkrlndmndifkdrreeyyfr
Timeline for d1j31b_: