![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Hypothetical rubrerythrin [101130] (1 species) |
![]() | Species Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry) |
![]() | Domain d1j30b_: 1j30 B: [90807] segment-swapped dimer complexed with fe, oxy, zn |
PDB Entry: 1j30 (more details), 1.7 Å
SCOPe Domain Sequences for d1j30b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j30b_ a.25.1.1 (B:) Hypothetical rubrerythrin {Sulfolobus tokodaii [TaxId: 111955]} dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl araekshaekfqnvlkq
Timeline for d1j30b_: