Lineage for d1j30b_ (1j30 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 353828Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 354127Protein Hypothetical rubrerythrin [101130] (1 species)
  7. 354128Species Archaeon Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry)
  8. 354130Domain d1j30b_: 1j30 B: [90807]
    segment-swapped dimer
    complexed with fe, o2, zn

Details for d1j30b_

PDB Entry: 1j30 (more details), 1.7 Å

PDB Description: The crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon

SCOP Domain Sequences for d1j30b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j30b_ a.25.1.1 (B:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii}
dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
araekshaekfqnvlkq

SCOP Domain Coordinates for d1j30b_:

Click to download the PDB-style file with coordinates for d1j30b_.
(The format of our PDB-style files is described here.)

Timeline for d1j30b_: