Lineage for d1j30b_ (1j30 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein Hypothetical rubrerythrin [101130] (1 species)
  7. Species Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry)
  8. Domain d1j30b_: 1j30 B: [90807]
    segment-swapped dimer
    complexed with fe, oxy, zn

Details for d1j30b_

PDB Entry: 1j30 (more details), 1.7 Å

PDB Description: The crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon
PDB Compounds: (B:) 144aa long hypothetical rubrerythrin

SCOPe Domain Sequences for d1j30b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j30b_ a.25.1.1 (B:) Hypothetical rubrerythrin {Sulfolobus tokodaii [TaxId: 111955]}
dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
araekshaekfqnvlkq

SCOPe Domain Coordinates for d1j30b_ are not available.

Timeline for d1j30b_:

Domains from other chains:
(mouse over for more information)
d1j30a_