SCOPe 2.06: Domain d1j30a_: 1j30 A:

Lineage for d1j30a_ (1j30 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Hypothetical rubrerythrin [101130] (1 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry)

8. Domain d1j30a_: 1j30 A: [90806]
   segment-swapped dimer
   complexed with fe, oxy, zn

Details for d1j30a_

PDB Entry: 1j30, 1.7 Å

PDB Description: The crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon

PDB Compounds: (A:) 144aa long hypothetical rubrerythrin

SCOPe Domain Sequences for d1j30a_:

Sequence; same for both SEQRES and ATOM records:

>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Sulfolobus tokodaii [TaxId: 111955]}
dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
araekshaekfqnvlkqlkgg

Timeline for d1j30a_:

• d1j30a_ first appeared in SCOP 1.67
  
• d1j30a_ appears in SCOPe 2.05
  
• d1j30a_ appears in SCOPe 2.07
  
• d1j30a_ appears in the current release, SCOPe 2.08