Lineage for d1j30a_ (1j30 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702124Protein Hypothetical rubrerythrin [101130] (1 species)
  7. 2702125Species Sulfolobus tokodaii [TaxId:111955] [101131] (1 PDB entry)
  8. 2702126Domain d1j30a_: 1j30 A: [90806]
    segment-swapped dimer
    complexed with fe, oxy, zn

Details for d1j30a_

PDB Entry: 1j30 (more details), 1.7 Å

PDB Description: The crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon
PDB Compounds: (A:) 144aa long hypothetical rubrerythrin

SCOPe Domain Sequences for d1j30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Sulfolobus tokodaii [TaxId: 111955]}
dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
araekshaekfqnvlkqlkgg

SCOPe Domain Coordinates for d1j30a_:

Click to download the PDB-style file with coordinates for d1j30a_.
(The format of our PDB-style files is described here.)

Timeline for d1j30a_: