Lineage for d1j2za_ (1j2z A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381026Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 381027Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 381028Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
    this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain
  6. 381029Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)
  7. 381032Species Helicobacter pylori [TaxId:210] [101964] (1 PDB entry)
  8. 381033Domain d1j2za_: 1j2z A: [90805]
    complexed with so4, sog, tar

Details for d1j2za_

PDB Entry: 1j2z (more details), 2.1 Å

PDB Description: crystal structure of udp-n-acetylglucosamine acyltransferase

SCOP Domain Sequences for d1j2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori}
skiaktaiispkaeinkgveigefcvigdgvkldegvklhnnvtlqghtfvgknteifpf
avlgtqpqdlkykgeyseliigednlirefcminpgteggikktligdknllmayvhvah
dcvigshcilangvtlaghieigdyvniggltaihqfvriakgcmiagksalgkdvppyc
tvegnrafirglnrhrmrqlleskdidfiyalykrlfrpipslresakleleehannpfv
keicsfilessrgvaykss

SCOP Domain Coordinates for d1j2za_:

Click to download the PDB-style file with coordinates for d1j2za_.
(The format of our PDB-style files is described here.)

Timeline for d1j2za_: