Lineage for d1j2va_ (1j2v A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907588Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 1907589Protein Cut A1 [89931] (5 species)
  7. 1907617Species Pyrococcus horikoshii [TaxId:53953] [102974] (6 PDB entries)
    Uniprot O58720
  8. 1907636Domain d1j2va_: 1j2v A: [90804]

Details for d1j2va_

PDB Entry: 1j2v (more details), 2 Å

PDB Description: crystal structure of cuta1 from pyrococcus horikoshii
PDB Compounds: (A:) 102AA long hypothetical periplasmic divalent cation tolerance protein CUTA

SCOPe Domain Sequences for d1j2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2va_ d.58.5.2 (A:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkermiacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

SCOPe Domain Coordinates for d1j2va_:

Click to download the PDB-style file with coordinates for d1j2va_.
(The format of our PDB-style files is described here.)

Timeline for d1j2va_: