Lineage for d1j2tf_ (1j2t F:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405035Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 405036Superfamily c.125.1: Creatininase [102215] (1 family) (S)
  5. 405037Family c.125.1.1: Creatininase [102216] (1 protein)
  6. 405038Protein Creatininase [102217] (1 species)
  7. 405039Species Pseudomonas putida [TaxId:303] [102218] (4 PDB entries)
  8. 405051Domain d1j2tf_: 1j2t F: [90797]
    complexed with mn, sul, zn

Details for d1j2tf_

PDB Entry: 1j2t (more details), 1.8 Å

PDB Description: Creatininase Mn

SCOP Domain Sequences for d1j2tf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2tf_ c.125.1.1 (F:) Creatininase {Pseudomonas putida}
ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
evcvqgiadaireefpp

SCOP Domain Coordinates for d1j2tf_:

Click to download the PDB-style file with coordinates for d1j2tf_.
(The format of our PDB-style files is described here.)

Timeline for d1j2tf_: