![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (1 family) ![]() |
![]() | Family c.33.1.3: Isochorismatase-like hydrolases [100948] (5 proteins) |
![]() | Protein Hypothetical protein YecD [102298] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102299] (1 PDB entry) |
![]() | Domain d1j2rc_: 1j2r C: [90790] |
PDB Entry: 1j2r (more details), 1.3 Å
SCOP Domain Sequences for d1j2rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2rc_ c.33.1.3 (C:) Hypothetical protein YecD {Escherichia coli} lelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsad yaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrgi dtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsv eeilnal
Timeline for d1j2rc_: