SCOPe 2.05: Domain d1j2rb_: 1j2r B:

Lineage for d1j2rb_ (1j2r B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)

6. Protein Hypothetical protein YecD [102298] (1 species)

7. Species Escherichia coli [TaxId:562] [102299] (1 PDB entry)

8. Domain d1j2rb_: 1j2r B: [90789]
   structural genomics
   complexed with mpd

Details for d1j2rb_

PDB Entry: 1j2r, 1.3 Å

PDB Description: crystal structure of escherichia coli gene product yecd at 1.3 a resolution

PDB Compounds: (B:) Hypothetical isochorismatase family protein yecD

SCOPe Domain Sequences for d1j2rb_:

Sequence; same for both SEQRES and ATOM records:

>d1j2rb_ c.33.1.3 (B:) Hypothetical protein YecD {Escherichia coli [TaxId: 562]}
lnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsadya
ealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrgidt
ivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsvee
ilnal

Timeline for d1j2rb_:

• d1j2rb_ first appeared in SCOP 1.67
  
• d1j2rb_ appears in SCOPe 2.04
  
• d1j2rb_ appears in SCOPe 2.06
  
• d1j2rb_ appears in the current release, SCOPe 2.08