Lineage for d1j2rb_ (1j2r B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483313Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 483314Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (1 family) (S)
  5. 483315Family c.33.1.3: Isochorismatase-like hydrolases [100948] (6 proteins)
  6. 483316Protein Hypothetical protein YecD [102298] (1 species)
  7. 483317Species Escherichia coli [TaxId:562] [102299] (1 PDB entry)
  8. 483319Domain d1j2rb_: 1j2r B: [90789]

Details for d1j2rb_

PDB Entry: 1j2r (more details), 1.3 Å

PDB Description: crystal structure of escherichia coli gene product yecd at 1.3 a resolution

SCOP Domain Sequences for d1j2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2rb_ c.33.1.3 (B:) Hypothetical protein YecD {Escherichia coli}
lnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsadya
ealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrgidt
ivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsvee
ilnal

SCOP Domain Coordinates for d1j2rb_:

Click to download the PDB-style file with coordinates for d1j2rb_.
(The format of our PDB-style files is described here.)

Timeline for d1j2rb_: